Lineage for d4fp8n2 (4fp8 N:107-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751376Domain d4fp8n2: 4fp8 N:107-213 [221430]
    Other proteins in same PDB: d4fp8a_, d4fp8b_, d4fp8c_, d4fp8d_, d4fp8h_, d4fp8i_, d4fp8j_, d4fp8k_, d4fp8l1, d4fp8m1, d4fp8n1, d4fp8o1
    automated match to d1dn0a2
    complexed with nag, zn

Details for d4fp8n2

PDB Entry: 4fp8 (more details), 2.95 Å

PDB Description: crystal structure of broadly neutralizing antibody c05 bound to h3 influenza hemagglutinin, ha1 subunit
PDB Compounds: (N:) Antibody C05, Light Chain

SCOPe Domain Sequences for d4fp8n2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fp8n2 b.1.1.2 (N:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d4fp8n2:

Click to download the PDB-style file with coordinates for d4fp8n2.
(The format of our PDB-style files is described here.)

Timeline for d4fp8n2: