![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein Hemagglutinin [49824] (22 species) includes rudiment esterase domain |
![]() | Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries) |
![]() | Domain d4fp8d_: 4fp8 D: [221424] Other proteins in same PDB: d4fp8h_, d4fp8i_, d4fp8j_, d4fp8k_, d4fp8l1, d4fp8l2, d4fp8m1, d4fp8m2, d4fp8n1, d4fp8n2, d4fp8o1, d4fp8o2 automated match to d2visc_ complexed with nag, zn |
PDB Entry: 4fp8 (more details), 2.95 Å
SCOPe Domain Sequences for d4fp8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fp8d_ b.19.1.2 (D:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} qssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncypydvp dyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypv lnvtmpnndnfdklyiwgvhhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwv rglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecit pngsipndkpfqnvnkitygacpkyv
Timeline for d4fp8d_: