Lineage for d4fp8c_ (4fp8 C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778136Protein Hemagglutinin [49824] (7 species)
    includes rudiment esterase domain
  7. 1778153Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries)
  8. 1778269Domain d4fp8c_: 4fp8 C: [221423]
    Other proteins in same PDB: d4fp8l1, d4fp8l2, d4fp8m1, d4fp8m2, d4fp8n1, d4fp8n2, d4fp8o1, d4fp8o2
    automated match to d2visc_
    complexed with nag, zn

Details for d4fp8c_

PDB Entry: 4fp8 (more details), 2.95 Å

PDB Description: crystal structure of broadly neutralizing antibody c05 bound to h3 influenza hemagglutinin, ha1 subunit
PDB Compounds: (C:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4fp8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fp8c_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncypydvp
dyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypv
lnvtmpnndnfdklyiwgvhhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwv
rglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecit
pngsipndkpfqnvnkitygacpky

SCOPe Domain Coordinates for d4fp8c_:

Click to download the PDB-style file with coordinates for d4fp8c_.
(The format of our PDB-style files is described here.)

Timeline for d4fp8c_: