SCOPe 2.05: Domain d4fota_: 4fot A:

Lineage for d4fota_ (4fot A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.0: automated matches [193325] (1 protein)
   not a true family

6. Protein automated matches [193326] (7 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:575584] [196867] (11 PDB entries)

8. Domain d4fota_: 4fot A: [221412]
   automated match to d4jy7a_
   complexed with edo, gol, peg

Details for d4fota_

PDB Entry: 4fot, 2.2 Å

PDB Description: Crystal structure of Peptidyl- tRNA Hydrolase from Acinetobacter baumannii at 2.20 A resolution

PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4fota_:

Sequence; same for both SEQRES and ATOM records:

>d4fota_ c.56.3.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
pqamnqinaykpa

Timeline for d4fota_:

• d4fota_ first appeared in SCOPe 2.03
  
• d4fota_ appears in SCOPe 2.04
  
• d4fota_ appears in SCOPe 2.06
  
• d4fota_ appears in the current release, SCOPe 2.08