SCOPe 2.04: Domain d4fooa1: 4foo A:1-104

Lineage for d4fooa1 (4foo A:1-104)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (21 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [226243] (10 PDB entries)

8. Domain d4fooa1: 4foo A:1-104 [221405]
   Other proteins in same PDB: d4fooa2, d4foob2
   automated match to d1p77a2
   mutant

Details for d4fooa1

PDB Entry: 4foo, 2.55 Å

PDB Description: Crystal Structure of Shikimate Dehydrogenase (aroE) Q237K Mutant from Helicobacter pylori

PDB Compounds: (A:) Shikimate dehydrogenase

SCOPe Domain Sequences for d4fooa1:

Sequence; same for both SEQRES and ATOM records:

>d4fooa1 c.58.1.0 (A:1-104) automated matches {Helicobacter pylori [TaxId: 85962]}
mklksfgvfgnpikhsksplihnacfltfqkelrflghyhpillpleshikseflhlgls
ganvtlpfkerafqvcdkikgialecgavntlvlendelvgynt

Timeline for d4fooa1:

• d4fooa1 first appeared in SCOPe 2.03
  
• d4fooa1 appears in SCOPe 2.05
  
• d4fooa1 appears in the current release, SCOPe 2.08