Lineage for d4foeb4 (4foe B:671-914)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1857983Family c.55.1.3: Hexokinase [53083] (3 proteins)
  6. 1858005Protein Mammalian type I hexokinase [53086] (2 species)
    further duplication: consists of two very similar lobes
  7. 1858006Species Human (Homo sapiens) [TaxId:9606] [53087] (10 PDB entries)
  8. 1858054Domain d4foeb4: 4foe B:671-914 [221400]
    automated match to d1hkba4
    complexed with bgc, cit, m6d, na

Details for d4foeb4

PDB Entry: 4foe (more details), 2.7 Å

PDB Description: crystal structure of recombinant human hexokinase type i with mannose 6-phosphate
PDB Compounds: (B:) Hexokinase-1

SCOPe Domain Sequences for d4foeb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4foeb4 c.55.1.3 (B:671-914) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]}
tcevglivgtgsnacymeemknvemvegdqgqmcinmewgafgdngclddirthydrlvd
eyslnagkqryekmisgmylgeivrnilidftkkgflfrgqisetlktrgifetkflsqi
esdrlallqvrailqqlglnstcddsilvktvcgvvsrraaqlcgagmaavvdkirenrg
ldrlnvtvgvdgtlyklhphfsrimhqtvkelspkcnvsfllsedgsgkgaalitavgvr
lrte

SCOPe Domain Coordinates for d4foeb4:

Click to download the PDB-style file with coordinates for d4foeb4.
(The format of our PDB-style files is described here.)

Timeline for d4foeb4: