![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.3: Hexokinase [53083] (3 proteins) |
![]() | Protein Mammalian type I hexokinase [53086] (2 species) further duplication: consists of two very similar lobes |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53087] (6 PDB entries) |
![]() | Domain d4foea1: 4foe A:16-222 [221393] automated match to d1hkba1 complexed with bgc, cit, m6d, na |
PDB Entry: 4foe (more details), 2.7 Å
SCOPe Domain Sequences for d4foea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4foea1 c.55.1.3 (A:16-222) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} ddqvkkidkylyamrlsdetlidimtrfrkemknglsrdfnptatvkmlptfvrsipdgs ekgdfialdlggssfrilrvqvnheknqnvhmesevydtpenivhgsgsqlfdhvaeclg dfmekrkikdkklpvgftfsfpcqqskideailitwtkrfkasgvegadvvkllnkaikk rgdydanivavvndtvgtmmtcgyddq
Timeline for d4foea1:
![]() Domains from other chains: (mouse over for more information) d4foeb1, d4foeb2, d4foeb3, d4foeb4 |