![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) ![]() automatically mapped to Pfam PF00303 |
![]() | Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) |
![]() | Protein automated matches [190469] (17 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [189990] (2 PDB entries) |
![]() | Domain d4foab_: 4foa B: [221389] Other proteins in same PDB: d4foaa2 automated match to d3qj7c_ complexed with ufp |
PDB Entry: 4foa (more details), 2.25 Å
SCOPe Domain Sequences for d4foab_:
Sequence, based on SEQRES records: (download)
>d4foab_ d.117.1.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} mtpyedllrfvletgtpksdrtgtgtrslfgqqmrydlsagfpllttkkvhfksvayell wflrgdsnigwlhehgvtiwdewasdtgelgpiygvqwrswpapsgehidqisaaldllr tdpdsrriivsawnvgeiermalppchaffqfyvadgrlscqlyqrsadlflgvpfnias yallthmmaaqaglsvgefiwtggdchiydnhveqvrlqlsreprpypkllladrdsife ytyedivvknydphpaikapv
>d4foab_ d.117.1.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} mtpyedllrfvletgtpksdtgtrslfgqqmrydlsagfpllttkkvhfksvayellwfl rgdsnigwlhehgvtiwdewasdtgelgpiygvqwrswpapsgehidqisaaldllrtdp dsrriivsawnvgeiermalppchaffqfyvadgrlscqlyqrsadlflgvpfniasyal lthmmaaqaglsvgefiwtggdchiydnhveqvrlqlsreprpypkllladrdsifeyty edivvknydphpaikapv
Timeline for d4foab_:
![]() Domains from other chains: (mouse over for more information) d4foaa1, d4foaa2, d4foac_, d4foad_ |