Lineage for d4fo8c1 (4fo8 C:2-261)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581092Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2581093Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2581094Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2581230Protein automated matches [195197] (7 species)
    not a true protein
  7. 2581243Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [226711] (3 PDB entries)
  8. 2581250Domain d4fo8c1: 4fo8 C:2-261 [221386]
    Other proteins in same PDB: d4fo8b2, d4fo8c2
    automated match to d4a6va_
    complexed with met, mn

Details for d4fo8c1

PDB Entry: 4fo8 (more details), 1.9 Å

PDB Description: pseudomonas aeruginosa metap with met, in mn form
PDB Compounds: (C:) Methionine aminopeptidase

SCOPe Domain Sequences for d4fo8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fo8c1 d.127.1.1 (C:2-261) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tvtiktpddiekmriagrlaaevlemigehikpgvtteeldrichdyivneqkaipapln
ykgfpksictsinhvvchgipnekplkegdilnvditvikdgyhgdtskmflvgktpewa
drlcqitqecmykgisvvrpgahlgdigeiiqkhaekngfsvvreycghgigkvfheepq
vlhygragtgielkegmiftiepminqgrpetrllgdgwtaitkdrklsaqwehtvlvta
dgyeiltlrndetfprtsaa

SCOPe Domain Coordinates for d4fo8c1:

Click to download the PDB-style file with coordinates for d4fo8c1.
(The format of our PDB-style files is described here.)

Timeline for d4fo8c1: