SCOPe 2.03: Domain d4fo8c_: 4fo8 C:

Lineage for d4fo8c_ (4fo8 C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)

6. Protein automated matches [195197] (3 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [226711] (2 PDB entries)

8. Domain d4fo8c_: 4fo8 C: [221386]
   automated match to d4a6va_
   complexed with met, mn

Details for d4fo8c_

PDB Entry: 4fo8, 1.9 Å

PDB Description: pseudomonas aeruginosa metap with met, in mn form

PDB Compounds: (C:) Methionine aminopeptidase

SCOPe Domain Sequences for d4fo8c_:

Sequence; same for both SEQRES and ATOM records:

>d4fo8c_ d.127.1.1 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
tvtiktpddiekmriagrlaaevlemigehikpgvtteeldrichdyivneqkaipapln
ykgfpksictsinhvvchgipnekplkegdilnvditvikdgyhgdtskmflvgktpewa
drlcqitqecmykgisvvrpgahlgdigeiiqkhaekngfsvvreycghgigkvfheepq
vlhygragtgielkegmiftiepminqgrpetrllgdgwtaitkdrklsaqwehtvlvta
dgyeiltlrndetfprtsaaefelvd

Timeline for d4fo8c_:

• d4fo8c_ is new in SCOPe 2.03-stable
  
• d4fo8c_ appears in SCOPe 2.04
  
• d4fo8c_ appears in the current release, SCOPe 2.08, called d4fo8c1