SCOPe 2.08: Domain d4fo8c1: 4fo8 C:2-261

Lineage for d4fo8c1 (4fo8 C:2-261)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)

6. Protein automated matches [195197] (6 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [226711] (3 PDB entries)

8. Domain d4fo8c1: 4fo8 C:2-261 [221386]
   Other proteins in same PDB: d4fo8b2, d4fo8c2
   automated match to d4a6va_
   complexed with met, mn

Details for d4fo8c1

PDB Entry: 4fo8, 1.9 Å

PDB Description: pseudomonas aeruginosa metap with met, in mn form

PDB Compounds: (C:) Methionine aminopeptidase

SCOPe Domain Sequences for d4fo8c1:

Sequence; same for both SEQRES and ATOM records:

>d4fo8c1 d.127.1.1 (C:2-261) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tvtiktpddiekmriagrlaaevlemigehikpgvtteeldrichdyivneqkaipapln
ykgfpksictsinhvvchgipnekplkegdilnvditvikdgyhgdtskmflvgktpewa
drlcqitqecmykgisvvrpgahlgdigeiiqkhaekngfsvvreycghgigkvfheepq
vlhygragtgielkegmiftiepminqgrpetrllgdgwtaitkdrklsaqwehtvlvta
dgyeiltlrndetfprtsaa

Timeline for d4fo8c1:

• d4fo8c1 first appeared in SCOPe 2.03, called d4fo8c_
  
• d4fo8c1 appears in SCOPe 2.07