Lineage for d4fo8b1 (4fo8 B:2-261)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974562Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2974563Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2974564Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2974703Protein automated matches [195197] (6 species)
    not a true protein
  7. 2974716Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [226711] (3 PDB entries)
  8. 2974722Domain d4fo8b1: 4fo8 B:2-261 [221385]
    Other proteins in same PDB: d4fo8b2, d4fo8c2
    automated match to d4a6va_
    complexed with met, mn

Details for d4fo8b1

PDB Entry: 4fo8 (more details), 1.9 Å

PDB Description: pseudomonas aeruginosa metap with met, in mn form
PDB Compounds: (B:) Methionine aminopeptidase

SCOPe Domain Sequences for d4fo8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fo8b1 d.127.1.1 (B:2-261) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tvtiktpddiekmriagrlaaevlemigehikpgvtteeldrichdyivneqkaipapln
ykgfpksictsinhvvchgipnekplkegdilnvditvikdgyhgdtskmflvgktpewa
drlcqitqecmykgisvvrpgahlgdigeiiqkhaekngfsvvreycghgigkvfheepq
vlhygragtgielkegmiftiepminqgrpetrllgdgwtaitkdrklsaqwehtvlvta
dgyeiltlrndetfprtsaa

SCOPe Domain Coordinates for d4fo8b1:

Click to download the PDB-style file with coordinates for d4fo8b1.
(The format of our PDB-style files is described here.)

Timeline for d4fo8b1: