Lineage for d4fo7d_ (4fo7 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974562Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2974563Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2974564Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2974703Protein automated matches [195197] (6 species)
    not a true protein
  7. 2974716Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [226711] (3 PDB entries)
  8. 2974720Domain d4fo7d_: 4fo7 D: [221383]
    automated match to d4a6va_
    complexed with mn

Details for d4fo7d_

PDB Entry: 4fo7 (more details), 1.8 Å

PDB Description: pseudomonas aeruginosa metap, in mn form
PDB Compounds: (D:) Methionine aminopeptidase

SCOPe Domain Sequences for d4fo7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fo7d_ d.127.1.1 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tvtiktpddiekmriagrlaaevlemigehikpgvtteeldrichdyivneqkaipapln
ykgfpksictsinhvvchgipnekplkegdilnvditvikdgyhgdtskmflvgktpewa
drlcqitqecmykgisvvrpgahlgdigeiiqkhaekngfsvvreycghgigkvfheepq
vlhygragtgielkegmiftiepminqgrpetrllgdgwtaitkdrklsaqwehtvlvta
dgyeiltlrndetfprts

SCOPe Domain Coordinates for d4fo7d_:

Click to download the PDB-style file with coordinates for d4fo7d_.
(The format of our PDB-style files is described here.)

Timeline for d4fo7d_: