![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
![]() | Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) ![]() |
![]() | Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
![]() | Protein automated matches [195197] (6 species) not a true protein |
![]() | Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [226711] (3 PDB entries) |
![]() | Domain d4fo7c_: 4fo7 C: [221382] automated match to d4a6va_ complexed with mn |
PDB Entry: 4fo7 (more details), 1.8 Å
SCOPe Domain Sequences for d4fo7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fo7c_ d.127.1.1 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} tvtiktpddiekmriagrlaaevlemigehikpgvtteeldrichdyivneqkaipapln ykgfpksictsinhvvchgipnekplkegdilnvditvikdgyhgdtskmflvgktpewa drlcqitqecmykgisvvrpgahlgdigeiiqkhaekngfsvvreycghgigkvfheepq vlhygragtgielkegmiftiepminqgrpetrllgdgwtaitkdrklsaqwehtvlvta dgyeiltlrndetfprts
Timeline for d4fo7c_: