SCOPe 2.04: Domain d1ghom2: 1gho M:626-730

Lineage for d1ghom2 (1gho M:626-730)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)

6. Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)

7. Species Escherichia coli [TaxId:562] [49306] (41 PDB entries)
   Uniprot P00722

8. Domain d1ghom2: 1gho M:626-730 [22138]
   Other proteins in same PDB: d1ghoi3, d1ghoi4, d1ghoi5, d1ghoj3, d1ghoj4, d1ghoj5, d1ghok3, d1ghok4, d1ghok5, d1ghol3, d1ghol4, d1ghol5, d1ghom3, d1ghom4, d1ghom5, d1ghon3, d1ghon4, d1ghon5, d1ghoo3, d1ghoo4, d1ghoo5, d1ghop3, d1ghop4, d1ghop5
   complexed with mg

Details for d1ghom2

PDB Entry: 1gho, 2.5 Å

PDB Description: e. coli (lac z) beta-galactosidase (ncs constrained monomer-monoclinic)

PDB Compounds: (M:) beta-galactosidase

SCOPe Domain Sequences for d1ghom2:

Sequence; same for both SEQRES and ATOM records:

>d1ghom2 b.1.4.1 (M:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

Timeline for d1ghom2:

• d1ghom2 first appeared (with stable ids) in SCOP 1.55
  
• d1ghom2 appears in SCOPe 2.03
  
• d1ghom2 appears in SCOPe 2.05
  
• d1ghom2 appears in the current release, SCOPe 2.08