SCOPe 2.08: Domain d4fnob_: 4fno B:

Lineage for d4fnob_ (4fno B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.0: automated matches [193325] (1 protein)
   not a true family

6. Protein automated matches [193326] (11 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [193327] (9 PDB entries)

8. Domain d4fnob_: 4fno B: [221375]
   automated match to d4jc4a_
   complexed with gol, peg

Details for d4fnob_

PDB Entry: 4fno, 2.25 Å

PDB Description: Crystal structure of peptidyl t-RNA hydrolase from Pseudomonas aeruginosa at 2.2 Angstrom resolution

PDB Compounds: (B:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4fnob_:

Sequence; same for both SEQRES and ATOM records:

>d4fnob_ c.56.3.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mtavqlivglgnpgpeydqtrhnagalfverlahaqgvslvadrkyfglvgkfshqgkdv
rllipttymnrsgqsvaalagffriapdailvahdeldmppgvaklktggghgghnglrd
iiaqlgnqnsfhrlrlgighpghsslvsgyvlgraprseqelldtsidfalgvlpemlag
dwtramqklhsqka

Timeline for d4fnob_:

• d4fnob_ first appeared in SCOPe 2.03
  
• d4fnob_ appears in SCOPe 2.07