Lineage for d4fnke1 (4fnk E:11-326)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2040364Domain d4fnke1: 4fnk E:11-326 [221369]
    Other proteins in same PDB: d4fnka2, d4fnkb_, d4fnkc2, d4fnkd_, d4fnke2, d4fnkf_
    automated match to d2viua_
    complexed with gol, nag, so4

Details for d4fnke1

PDB Entry: 4fnk (more details), 1.9 Å

PDB Description: Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin
PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4fnke1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fnke1 b.19.1.2 (E:11-326) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
qtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsngn
liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvpek

SCOPe Domain Coordinates for d4fnke1:

Click to download the PDB-style file with coordinates for d4fnke1.
(The format of our PDB-style files is described here.)

Timeline for d4fnke1: