SCOPe 2.08: Domain d4fmpa_: 4fmp A:

Lineage for d4fmpa_ (4fmp A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
   lack the first two strands of the common fold

6. Protein automated matches [190277] (12 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [226739] (12 PDB entries)

8. Domain d4fmpa_: 4fmp A: [221363]
   automated match to d2w22a_
   complexed with ca, zn

Details for d4fmpa_

PDB Entry: 4fmp, 2.3 Å

PDB Description: Crystal structure of thermostable, organic-solvent tolerant lipase from Geobacillus sp. strain ARM

PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d4fmpa_:

Sequence; same for both SEQRES and ATOM records:

>d4fmpa_ c.69.1.18 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
andapivllhgftgwgreemfgfkywggvrgdieqwlndngyrtytlavgplssnwdrac
eayaqlvggtvdygaahaakhgharfgrtypgllpelkrggrihiiahsqggqtarmlvs
llengsqeereyakahnvslsplfegghhfvlsvttiatphdgttlvnmvdftdrffdlq
kavlkaaavasnvpytsqvydfkldqwglrrqpgesfdqyferlkrspvwtstdtarydl
svpgaeklnqwvkaspntyylsfatertyrgaltgnyypelgmnafsavvcapflgsyrn
atlgiddrwlendgivntfsmngpkrgstdrivpydgtikkgvwndmgtynvdhlevigv
dpnplfdirafylrlaeqlas

Timeline for d4fmpa_:

• d4fmpa_ first appeared in SCOPe 2.03
  
• d4fmpa_ appears in SCOPe 2.07