Lineage for d4fmjb_ (4fmj B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1812227Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1813264Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 1813265Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)
  6. 1813335Protein automated matches [191200] (6 species)
    not a true protein
  7. 1813480Species Merkel cell polyomavirus [TaxId:493803] [226460] (4 PDB entries)
  8. 1813542Domain d4fmjb_: 4fmj B: [221344]
    automated match to d1vpsb_
    complexed with cl, gol, sia

Details for d4fmjb_

PDB Entry: 4fmj (more details), 2.4 Å

PDB Description: merkel cell polyomavirus vp1 in complex with gd1a oligosaccharide
PDB Compounds: (B:) vp1

SCOPe Domain Sequences for d4fmjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fmjb_ b.121.6.1 (B:) automated matches {Merkel cell polyomavirus [TaxId: 493803]}
vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
aysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvs
gvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqgldpqakak
ldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckg
dglfiscadivgflfktsgkmalhglpryfnvtlrkrwvk

SCOPe Domain Coordinates for d4fmjb_:

Click to download the PDB-style file with coordinates for d4fmjb_.
(The format of our PDB-style files is described here.)

Timeline for d4fmjb_: