![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) ![]() |
![]() | Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins) |
![]() | Protein automated matches [191200] (3 species) not a true protein |
![]() | Species Merkel cell polyomavirus [TaxId:493803] [226460] (4 PDB entries) |
![]() | Domain d4fmja_: 4fmj A: [221343] automated match to d1vpsb_ complexed with cl, gol, sia |
PDB Entry: 4fmj (more details), 2.4 Å
SCOPe Domain Sequences for d4fmja_:
Sequence, based on SEQRES records: (download)
>d4fmja_ b.121.6.1 (A:) automated matches {Merkel cell polyomavirus [TaxId: 493803]} evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa ysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsg vnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqgldpqakakl dkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgd glfiscadivgflfktsgkmalhglpryfnvtlrkrwvk
>d4fmja_ b.121.6.1 (A:) automated matches {Merkel cell polyomavirus [TaxId: 493803]} evlsvvtgedsitqielylnprmgvnspdlptsnwytytydlqpkgsspdqpikenlpay svarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmfa iggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypiev wcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscadiv gflfktsgkmalhglpryfnvtlrkrwvk
Timeline for d4fmja_: