Lineage for d4fmgm_ (4fmg M:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2076457Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2076458Family b.121.6.1: Papovaviridae-like VP [88649] (3 protein domains)
  6. 2076528Protein automated matches [191200] (7 species)
    not a true protein
  7. 2076673Species Merkel cell polyomavirus [TaxId:493803] [226460] (4 PDB entries)
  8. 2076726Domain d4fmgm_: 4fmg M: [221295]
    automated match to d1vpsb_
    complexed with cl, gol

Details for d4fmgm_

PDB Entry: 4fmg (more details), 2.1 Å

PDB Description: Merkel Cell Polyomavirus VP1 Unassembled Pentamer
PDB Compounds: (M:) vp1

SCOPe Domain Sequences for d4fmgm_:

Sequence, based on SEQRES records: (download)

>d4fmgm_ b.121.6.1 (M:) automated matches {Merkel cell polyomavirus [TaxId: 493803]}
evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
ysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsg
vnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqgldpqakakl
dkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgd
glfiscadivgflfktsgkmalhglpryfnvtlrkrwvk

Sequence, based on observed residues (ATOM records): (download)

>d4fmgm_ b.121.6.1 (M:) automated matches {Merkel cell polyomavirus [TaxId: 493803]}
evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
ysvarvslpmlnlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmfa
iggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypiev
wcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscadiv
gflfktsgkmalhglpryfnvtlrkrwvk

SCOPe Domain Coordinates for d4fmgm_:

Click to download the PDB-style file with coordinates for d4fmgm_.
(The format of our PDB-style files is described here.)

Timeline for d4fmgm_: