Lineage for d4fm5d2 (4fm5 D:73-583)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002843Family a.93.1.2: Myeloperoxidase-like [48132] (3 protein domains)
  6. 2002863Protein Prostaglandin H2 synthase [48136] (2 species)
    contains EGF-like module
  7. 2002864Species Mouse (Mus musculus) [TaxId:10090] [48138] (12 PDB entries)
  8. 2002882Domain d4fm5d2: 4fm5 D:73-583 [221282]
    Other proteins in same PDB: d4fm5a1, d4fm5b1, d4fm5c1, d4fm5d1
    automated match to d1pxxa1
    complexed with bog, df0, hem

Details for d4fm5d2

PDB Entry: 4fm5 (more details), 2.81 Å

PDB Description: X-ray structure of des-methylflurbiprofen bound to murine COX-2
PDB Compounds: (D:) Prostaglandin G/H synthase 2

SCOPe Domain Sequences for d4fm5d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fm5d2 a.93.1.2 (D:73-583) Prostaglandin H2 synthase {Mouse (Mus musculus) [TaxId: 10090]}
fltriklllkptpntvhyilthfkgvwnivnnipflrslimkyvltsrsylidspptynv
hygyksweafsnlsyytralppvaddcptpmgvkgnkelpdskevlekvllrrefipdpq
gsnmmfaffaqhfthqffktdhkrgpgftrglghgvdlnhiygetldrqhklrlfkdgkl
kyqviggevypptvkdtqvemiypphipenlqfavgqevfglvpglmmyatiwlrehnrv
cdilkqehpewgdeqlfqtsrliligetikiviedyvqhlsgyhfklkfdpellfnqqfq
yqnriasefntlyhwhpllpdtfniedqeysfkqflynnsillehgltqfvesftrqiag
rvaggrnvpiavqavakasidqsremkyqslneyrkrfslkpytsfeeltgekemaaelk
alysdidvmelypallvekprpdaifgetmvelgapfslkglmgnpicspqywkpstfgg
evgfkiintasiqslicnnvkgcpftsfnvq

SCOPe Domain Coordinates for d4fm5d2:

Click to download the PDB-style file with coordinates for d4fm5d2.
(The format of our PDB-style files is described here.)

Timeline for d4fm5d2: