Lineage for d1f49h2 (1f49 H:626-730)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) 
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins) Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species) Species Escherichia coli [TaxId:562] [49306] (7 PDB entries) 
Domain d1f49h2: 1f49 H:626-730 [22128]
Other proteins in same PDB: d1f49a3, d1f49a4, d1f49a5, d1f49b3, d1f49b4, d1f49b5, d1f49c3, d1f49c4, d1f49c5, d1f49d3, d1f49d4, d1f49d5, d1f49e3, d1f49e4, d1f49e5, d1f49f3, d1f49f4, d1f49f5, d1f49g3, d1f49g4, d1f49g5, d1f49h3, d1f49h4, d1f49h5
Details for d1f49h2
PDB Entry: 1f49 (more details), 2.5 Å
PDB Description: e. coli (lac z) beta-galactosidase (ncs constrained monomer-monoclinic)
SCOP Domain Sequences for d1f49h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f49h2 b.1.4.1 (H:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
SCOP Domain Coordinates for d1f49h2:
Click to download the PDB-style file with coordinates for d1f49h2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f49h2:
- d1f49h2 appears in SCOP 1.57
- d1f49h2 appears in the current release, SCOPe 2.08
 View in 3DDomains from same chain: (mouse over for more information) d1f49h1, d1f49h3, d1f49h4, d1f49h5 |
| View in 3D Domains from other chains: (mouse over for more information) d1f49a1, d1f49a2, d1f49a3, d1f49a4, d1f49a5, d1f49b1, d1f49b2, d1f49b3, d1f49b4, d1f49b5, d1f49c1, d1f49c2, d1f49c3, d1f49c4, d1f49c5, d1f49d1, d1f49d2, d1f49d3, d1f49d4, d1f49d5, d1f49e1, d1f49e2, d1f49e3, d1f49e4, d1f49e5, d1f49f1, d1f49f2, d1f49f3, d1f49f4, d1f49f5, d1f49g1, d1f49g2, d1f49g3, d1f49g4, d1f49g5 |
