Lineage for d4flra2 (4flr A:555-628)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1555652Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1555653Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1556225Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 1556226Protein automated matches [226835] (27 species)
    not a true protein
  7. 1556295Species Neisseria polysaccharea [TaxId:489] [226281] (5 PDB entries)
  8. 1556299Domain d4flra2: 4flr A:555-628 [221272]
    Other proteins in same PDB: d4flra1
    automated match to d1g5aa1
    complexed with 1pe, gol, trs; mutant

Details for d4flra2

PDB Entry: 4flr (more details), 2.4 Å

PDB Description: Crystal structure of Amylosucrase double mutant A289P-F290L from Neisseria polysaccharea
PDB Compounds: (A:) amylosucrase

SCOPe Domain Sequences for d4flra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4flra2 b.71.1.0 (A:555-628) automated matches {Neisseria polysaccharea [TaxId: 489]}
rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd
ltlqpyqvmwleia

SCOPe Domain Coordinates for d4flra2:

Click to download the PDB-style file with coordinates for d4flra2.
(The format of our PDB-style files is described here.)

Timeline for d4flra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4flra1