Lineage for d4flqa1 (4flq A:5-554)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2081497Family c.1.8.1: Amylase, catalytic domain [51446] (26 protein domains)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2081989Protein automated matches [190099] (25 species)
    not a true protein
  7. 2082088Species Neisseria polysaccharea [TaxId:489] [226280] (6 PDB entries)
  8. 2082093Domain d4flqa1: 4flq A:5-554 [221269]
    Other proteins in same PDB: d4flqa2, d4flqa3
    automated match to d1g5aa2
    complexed with gol, pg4, pge, trs; mutant

Details for d4flqa1

PDB Entry: 4flq (more details), 2.5 Å

PDB Description: Crystal structure of Amylosucrase double mutant A289P-F290I from Neisseria polysaccharea.
PDB Compounds: (A:) amylosucrase

SCOPe Domain Sequences for d4flqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4flqa1 c.1.8.1 (A:5-554) automated matches {Neisseria polysaccharea [TaxId: 489]}
qylktrildiytpeqragieksedwrqfsrrmdthfpklmneldsvygnneallpmleml
laqawqsysqrnsslkdidiarennpdwilsnkqvggvcyvdlfagdlkglkdkipyfqe
lgltylhlmplfkcpegksdggyavssyrdvnpalgtigdlreviaalheagisavvdfi
fnhtsnehewaqrcaagdplfdnfyyifpdrrmpdqydrtlreifpdqhpggfsqledgr
wvwttfnsfqwdlnysnpwvframagemlflanlgvdilrmdavpiiwkqmgtscenlpq
ahalirafnavmriaapavffkseaivhpdqvvqyigqdecqigynplqmallwntlatr
evnllhqaltyrhnlpehtawvnyvrshddigwtfadedaaylgisgydhrqflnrffvn
rfdgsfargvpfqynpstgdcrvsgtaaalvglaqddphavdrikllysialstgglpli
ylgdevgtlndddwsqdsnksddsrwahrprynealyaqrndpstaagqiyqdlrhmiav
rqsnprfdgg

SCOPe Domain Coordinates for d4flqa1:

Click to download the PDB-style file with coordinates for d4flqa1.
(The format of our PDB-style files is described here.)

Timeline for d4flqa1: