Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
Protein automated matches [191087] (19 species) not a true protein |
Species Trypanosoma brucei [TaxId:999953] [195043] (4 PDB entries) |
Domain d4fkxc_: 4fkx C: [221263] automated match to d4fkyc_ complexed with cdp, mg, mpd |
PDB Entry: 4fkx (more details), 1.7 Å
SCOPe Domain Sequences for d4fkxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fkxc_ d.58.6.0 (C:) automated matches {Trypanosoma brucei [TaxId: 999953]} mpsertfiavkpdgvqrnlvgeiikrfenkgyklvglkllqpteeqakqhyidlaskpfy sglvsyfssgpivgmvweglgvvkggrvllgatnpadslpgtirgdfavdvgrnvchgsd svesakreiafwfkaeelvswtshsvkqiyera
Timeline for d4fkxc_: