| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
| Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
| Protein automated matches [191087] (19 species) not a true protein |
| Species Trypanosoma brucei [TaxId:999953] [195043] (4 PDB entries) |
| Domain d4fkxb_: 4fkx B: [221262] automated match to d4fkyc_ complexed with cdp, mg, mpd |
PDB Entry: 4fkx (more details), 1.7 Å
SCOPe Domain Sequences for d4fkxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fkxb_ d.58.6.0 (B:) automated matches {Trypanosoma brucei [TaxId: 999953]}
psertfiavkpdgvqrnlvgeiikrfenkgyklvglkllqpteeqakqhyidlaskpfys
glvsyfssgpivgmvweglgvvkggrvllgatnpadslpgtirgdfavdvgrnvchgsds
vesakreiafwfkaeelvswtshsvkqiyera
Timeline for d4fkxb_: