SCOP 1.67: Domain d1f49g1: 1f49 G:220-333

Lineage for d1f49g1 (1f49 G:220-333)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)

6. Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)

7. Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)

8. Domain d1f49g1: 1f49 G:220-333 [22125]
   Other proteins in same PDB: d1f49a3, d1f49a4, d1f49a5, d1f49b3, d1f49b4, d1f49b5, d1f49c3, d1f49c4, d1f49c5, d1f49d3, d1f49d4, d1f49d5, d1f49e3, d1f49e4, d1f49e5, d1f49f3, d1f49f4, d1f49f5, d1f49g3, d1f49g4, d1f49g5, d1f49h3, d1f49h4, d1f49h5

Details for d1f49g1

PDB Entry: 1f49, 2.5 Å

PDB Description: e. coli (lac z) beta-galactosidase (ncs constrained monomer-monoclinic)

SCOP Domain Sequences for d1f49g1:

Sequence; same for both SEQRES and ATOM records:

>d1f49g1 b.1.4.1 (G:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

Timeline for d1f49g1:

• d1f49g1 first appeared (with stable ids) in SCOP 1.55
  
• d1f49g1 appears in SCOP 1.65
  
• d1f49g1 appears in SCOP 1.69
  
• d1f49g1 appears in the current release, SCOPe 2.08