SCOPe 2.05: Domain d4fk8a1: 4fk8 A:18-115

Lineage for d4fk8a1 (4fk8 A:18-115)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (16 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [226396] (2 PDB entries)

8. Domain d4fk8a1: 4fk8 A:18-115 [221244]
   Other proteins in same PDB: d4fk8a2, d4fk8b2
   automated match to d1a8pa1
   complexed with fad

Details for d4fk8a1

PDB Entry: 4fk8, 2.1 Å

PDB Description: crystal structure of ferredoxin-nadp reductase from burkholderia thailandensis e264 with bound fad

PDB Compounds: (A:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d4fk8a1:

Sequence; same for both SEQRES and ATOM records:

>d4fk8a1 b.43.4.0 (A:18-115) automated matches {Burkholderia thailandensis [TaxId: 271848]}
kfdtatvlsvhhwtdtlfsftctrdqalrfnngeftmvglevdgkpltraysivspnyee
hleffsikvqngpltsrlqhlkvgdpvligkkptgtlv

Timeline for d4fk8a1:

• d4fk8a1 first appeared in SCOPe 2.03
  
• d4fk8a1 appears in SCOPe 2.04
  
• d4fk8a1 appears in SCOPe 2.06
  
• d4fk8a1 appears in the current release, SCOPe 2.08