SCOPe 2.08: Domain d4fjqa1: 4fjq A:17-218

Lineage for d4fjqa1 (4fjq A:17-218)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.0: automated matches [227201] (1 protein)
   not a true family

6. Protein automated matches [226931] (12 species)
   not a true protein

7. Species Artemisia annua [TaxId:35608] [226616] (2 PDB entries)

8. Domain d4fjqa1: 4fjq A:17-218 [221239]
   Other proteins in same PDB: d4fjqa2
   automated match to d1hxga1

Details for d4fjqa1

PDB Entry: 4fjq, 2 Å

PDB Description: crystal structure of an alpha-bisabolol synthase

PDB Compounds: (A:) Amorpha-4,11-diene synthase

SCOPe Domain Sequences for d4fjqa1:

Sequence; same for both SEQRES and ATOM records:

>d4fjqa1 a.102.4.0 (A:17-218) automated matches {Artemisia annua [TaxId: 35608]}
psiwgdqflivdnqveqgveqivkdlkkevrqllkealdipmkhanllklvdeiqrlgis
ylfeqeidhalqhiyetygdnwsgdrsslwfrlmrkqgyfvtcdvfnnhkdesgvfkqsl
knhvegllelyeatsmrvpgeiiledalvftqshlsiiakdtlsinpalsteiqralkkp
lwkrlprieavqyipfyeqqds

Timeline for d4fjqa1:

• d4fjqa1 first appeared in SCOPe 2.03
  
• d4fjqa1 appears in SCOPe 2.07