SCOPe 2.07: Domain d4fj2c_: 4fj2 C:

Lineage for d4fj2c_ (4fj2 C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Cochliobolus lunatus [TaxId:5503] [225937] (9 PDB entries)

8. Domain d4fj2c_: 4fj2 C: [221237]
   automated match to d3uvea_
   complexed with edo, nap, qso

Details for d4fj2c_

PDB Entry: 4fj2, 2.5 Å

PDB Description: crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and biochanin a

PDB Compounds: (C:) 17beta-hydroxysteroid dehydrogenase

SCOPe Domain Sequences for d4fj2c_:

Sequence; same for both SEQRES and ATOM records:

>d4fj2c_ c.2.1.0 (C:) automated matches {Cochliobolus lunatus [TaxId: 5503]}
pgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsdaia
ikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntrgqf
fvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkkitv
navapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgflvs
kegewvngkvltldggaa

Timeline for d4fj2c_:

• d4fj2c_ first appeared in SCOPe 2.03
  
• d4fj2c_ appears in SCOPe 2.06
  
• d4fj2c_ appears in the current release, SCOPe 2.08