Lineage for d4fj2a_ (4fj2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846612Species Cochliobolus lunatus [TaxId:5503] [225937] (9 PDB entries)
  8. 2846632Domain d4fj2a_: 4fj2 A: [221235]
    automated match to d3uvea_
    complexed with edo, nap, qso

Details for d4fj2a_

PDB Entry: 4fj2 (more details), 2.5 Å

PDB Description: crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and biochanin a
PDB Compounds: (A:) 17beta-hydroxysteroid dehydrogenase

SCOPe Domain Sequences for d4fj2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fj2a_ c.2.1.0 (A:) automated matches {Cochliobolus lunatus [TaxId: 5503]}
yipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsda
iaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntrg
qffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkki
tvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgfl
vskegewvngkvltldggaa

SCOPe Domain Coordinates for d4fj2a_:

Click to download the PDB-style file with coordinates for d4fj2a_.
(The format of our PDB-style files is described here.)

Timeline for d4fj2a_: