SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4fj0b_ (4fj0 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (220 species)
    not a true protein
  7. 2094751Species Cochliobolus lunatus [TaxId:5503] [225937] (9 PDB entries)
  8. 2094768Domain d4fj0b_: 4fj0 B: [221228]
    automated match to d3uvea_
    complexed with edo, hhf, nap

Details for d4fj0b_

PDB Entry: 4fj0 (more details), 2.2 Å

PDB Description: Crystal structure of the ternary complex between a fungal 17beta-hydroxysteroid dehydrogenase (Holo form) and 3,7-dihydroxy flavone
PDB Compounds: (B:) 17beta-hydroxysteroid dehydrogenase

SCOPe Domain Sequences for d4fj0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fj0b_ c.2.1.0 (B:) automated matches {Cochliobolus lunatus [TaxId: 5503]}
yipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsda
iaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntrg
qffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkki
tvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgfl
vskegewvngkvltldggaa

SCOPe Domain Coordinates for d4fj0b_:

Click to download the PDB-style file with coordinates for d4fj0b_.
(The format of our PDB-style files is described here.)

Timeline for d4fj0b_: