![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
![]() | Protein automated matches [190417] (37 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [225619] (9 PDB entries) |
![]() | Domain d4ficb_: 4fic B: [221222] automated match to d2gqgb_ complexed with 0ul |
PDB Entry: 4fic (more details), 2.5 Å
SCOPe Domain Sequences for d4ficb_:
Sequence, based on SEQRES records: (download)
>d4ficb_ d.144.1.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkkl rheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayv ermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalyg rftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcq cwrkdpeerptfeylqafledyftstepqyqpgenl
>d4ficb_ d.144.1.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} daweipreslrlevklgqgcfgevwmgtwngttrvaiktlqvmkklrheklvqlyavvse epiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhrdlraan ilvgenlvckvadfgfpikwtapeaalygrftiksdvwsfgilltelttkgrvpypgmvn revldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyftstepqyq pgenl
Timeline for d4ficb_: