SCOP 1.59: Domain d1f49e2: 1f49 E:626-730

Lineage for d1f49e2 (1f49 E:626-730)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)

6. Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)

7. Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)

8. Domain d1f49e2: 1f49 E:626-730 [22122]
   Other proteins in same PDB: d1f49a3, d1f49a4, d1f49a5, d1f49b3, d1f49b4, d1f49b5, d1f49c3, d1f49c4, d1f49c5, d1f49d3, d1f49d4, d1f49d5, d1f49e3, d1f49e4, d1f49e5, d1f49f3, d1f49f4, d1f49f5, d1f49g3, d1f49g4, d1f49g5, d1f49h3, d1f49h4, d1f49h5

Details for d1f49e2

PDB Entry: 1f49, 2.5 Å

PDB Description: e. coli (lac z) beta-galactosidase (ncs constrained monomer-monoclinic)

SCOP Domain Sequences for d1f49e2:

Sequence; same for both SEQRES and ATOM records:

>d1f49e2 b.1.4.1 (E:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

Timeline for d1f49e2:

• d1f49e2 first appeared (with stable ids) in SCOP 1.55
  
• d1f49e2 appears in SCOP 1.57
  
• d1f49e2 appears in SCOP 1.61
  
• d1f49e2 appears in the current release, SCOPe 2.08