SCOPe 2.08: Domain d4fhqa2: 4fhq A:60-103

Lineage for d4fhqa2 (4fhq A:60-103)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.24: TNF receptor-like [57585] (1 superfamily)
   duplication: consists of three similar disulfide-rich domains

4. Superfamily g.24.1: TNF receptor-like [57586] (3 families)

5. Family g.24.1.0: automated matches [227277] (1 protein)
   not a true family

6. Protein automated matches [227086] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226418] (4 PDB entries)

8. Domain d4fhqa2: 4fhq A:60-103 [221216]
   Other proteins in same PDB: d4fhqa1
   automated match to d1jmab2

Details for d4fhqa2

PDB Entry: 4fhq, 2.25 Å

PDB Description: crystal structure of hvem

PDB Compounds: (A:) Tumor necrosis factor receptor superfamily member 14

SCOPe Domain Sequences for d4fhqa2:

Sequence; same for both SEQRES and ATOM records:

>d4fhqa2 g.24.1.0 (A:60-103) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mcdpamglrasrncsrtenavcgcspghfcivqdgdhcaacray

Timeline for d4fhqa2:

• d4fhqa2 first appeared in SCOPe 2.03
  
• d4fhqa2 appears in SCOPe 2.07