SCOPe 2.08: Domain d4fh6b_: 4fh6 B:

Lineage for d4fh6b_ (4fh6 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (32 PDB entries)

8. Domain d4fh6b_: 4fh6 B: [221214]
   automated match to d1ew6a_
   complexed with dms, hem, oxy, so4, tbp

Details for d4fh6b_

PDB Entry: 4fh6, 1.44 Å

PDB Description: Structure of DHP A in complex with 2,4,6-tribromophenol in 10% DMSO

PDB Compounds: (B:) Dehaloperoxidase A

SCOPe Domain Sequences for d4fh6b_:

Sequence; same for both SEQRES and ATOM records:

>d4fh6b_ a.1.1.2 (B:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d4fh6b_:

• d4fh6b_ first appeared in SCOPe 2.03
  
• d4fh6b_ appears in SCOPe 2.07