Lineage for d4fgsd_ (4fgs D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095817Species Rhizobium etli [TaxId:347834] [226316] (3 PDB entries)
  8. 2095821Domain d4fgsd_: 4fgs D: [221212]
    automated match to d1g6ka_
    complexed with so4

Details for d4fgsd_

PDB Entry: 4fgs (more details), 1.76 Å

PDB Description: Crystal structure of a probable dehydrogenase protein
PDB Compounds: (D:) Probable dehydrogenase protein

SCOPe Domain Sequences for d4fgsd_:

Sequence, based on SEQRES records: (download)

>d4fgsd_ c.2.1.0 (D:) automated matches {Rhizobium etli [TaxId: 347834]}
tqrlnakiavitgatsgiglaaakrfvaegarvfitgrrkdvldaaiaeigggavgiqad
sanlaeldrlyekvkaeagridvlfvnagggsmlplgevteeqyddtfdrnvkgvlftvq
kalpllargssvvltgstagstgtpafsvyaaskaalrsfarnwildlkdrgirintlsp
gptettglvelagkdpvqqqgllnalaaqvpmgrvgraeevaaaalflasddssfvtgae
lfvdggsaqv

Sequence, based on observed residues (ATOM records): (download)

>d4fgsd_ c.2.1.0 (D:) automated matches {Rhizobium etli [TaxId: 347834]}
tqrlnakiavitgatsgiglaaakrfvaegarvfitgrrkdvldaaiaeigggavgiqad
sanlaeldrlyekvkaeagridvlfvnagggsmlplgevteeqyddtfdrnvkgvlftvq
kalpllargssvvltgstagstgtpafsvyaaskaalrsfarnwildlkdrgirintlsp
gptegllnalaaqvpmgrvgraeevaaaalflasddssfvtgaelfvdggsaqv

SCOPe Domain Coordinates for d4fgsd_:

Click to download the PDB-style file with coordinates for d4fgsd_.
(The format of our PDB-style files is described here.)

Timeline for d4fgsd_: