SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4fgka_ (4fgk A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102350Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2102504Family c.23.5.3: Quinone reductase [52235] (4 protein domains)
    binds FAD
  6. 2102560Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)
  7. 2102561Species Human (Homo sapiens) [TaxId:9606] [52241] (63 PDB entries)
  8. 2102568Domain d4fgka_: 4fgk A: [221201]
    automated match to d3fw1a_
    complexed with 0tx, fad, zn

Details for d4fgka_

PDB Entry: 4fgk (more details), 1.4 Å

PDB Description: Oxidized quinone reductase 2 in complex with chloroquine
PDB Compounds: (A:) Ribosyldihydronicotinamide dehydrogenase [quinone]

SCOPe Domain Sequences for d4fgka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fgka_ c.23.5.3 (A:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq

SCOPe Domain Coordinates for d4fgka_:

Click to download the PDB-style file with coordinates for d4fgka_.
(The format of our PDB-style files is described here.)

Timeline for d4fgka_: