Lineage for d4fgjb_ (4fgj B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356722Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1356876Family c.23.5.3: Quinone reductase [52235] (4 proteins)
    binds FAD
  6. 1356932Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)
  7. 1356933Species Human (Homo sapiens) [TaxId:9606] [52241] (44 PDB entries)
  8. 1356939Domain d4fgjb_: 4fgj B: [221200]
    automated match to d3fw1a_
    complexed with 1pq, fad, gol, zn

Details for d4fgjb_

PDB Entry: 4fgj (more details), 1.35 Å

PDB Description: Oxidized quinone reductase 2 in complex with primaquine
PDB Compounds: (B:) Ribosyldihydronicotinamide dehydrogenase [quinone]

SCOPe Domain Sequences for d4fgjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fgjb_ c.23.5.3 (B:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq

SCOPe Domain Coordinates for d4fgjb_:

Click to download the PDB-style file with coordinates for d4fgjb_.
(The format of our PDB-style files is described here.)

Timeline for d4fgjb_: