Lineage for d4ffwl1 (4ffw L:1-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2371066Domain d4ffwl1: 4ffw L:1-106 [221196]
    Other proteins in same PDB: d4ffwa1, d4ffwa2, d4ffwb1, d4ffwb2, d4ffwc2, d4ffwl2
    automated match to d1sy6l1
    complexed with 715

Details for d4ffwl1

PDB Entry: 4ffw (more details), 2.9 Å

PDB Description: crystal structure of dipeptidyl peptidase iv (dpp4, dpp-iv, cd26) in complex with fab + sitagliptin
PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d4ffwl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ffwl1 b.1.1.0 (L:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qivlsqspailsaspgekvtmtcrasssvnnmhwyqqkpssspkpwlhgtsnlasgvpvr
fsgsgsgtsfsltisrveaedaatyfcqqwsnhpptfgggtkleid

SCOPe Domain Coordinates for d4ffwl1:

Click to download the PDB-style file with coordinates for d4ffwl1.
(The format of our PDB-style files is described here.)

Timeline for d4ffwl1: