![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (26 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (706 PDB entries) |
![]() | Domain d4ffwl1: 4ffw L:1-106 [221196] Other proteins in same PDB: d4ffwa1, d4ffwa2, d4ffwb1, d4ffwb2, d4ffwc2, d4ffwl2 automated match to d1sy6l1 complexed with 715 |
PDB Entry: 4ffw (more details), 2.9 Å
SCOPe Domain Sequences for d4ffwl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ffwl1 b.1.1.0 (L:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qivlsqspailsaspgekvtmtcrasssvnnmhwyqqkpssspkpwlhgtsnlasgvpvr fsgsgsgtsfsltisrveaedaatyfcqqwsnhpptfgggtkleid
Timeline for d4ffwl1: