SCOPe 2.06: Domain d4ffwc2: 4ffw C:107-210

Lineage for d4ffwc2 (4ffw C:107-210)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)

8. Domain d4ffwc2: 4ffw C:107-210 [221195]
   Other proteins in same PDB: d4ffwa1, d4ffwa2, d4ffwb1, d4ffwb2, d4ffwc1, d4ffwl1
   automated match to d1z3gl2
   complexed with 715

Details for d4ffwc2

PDB Entry: 4ffw, 2.9 Å

PDB Description: crystal structure of dipeptidyl peptidase iv (dpp4, dpp-iv, cd26) in complex with fab + sitagliptin

PDB Compounds: (C:) Fab light chain

SCOPe Domain Sequences for d4ffwc2:

Sequence, based on SEQRES records:

>d4ffwc2 b.1.1.2 (C:107-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Sequence, based on observed residues (ATOM records):

>d4ffwc2 b.1.1.2 (C:107-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgservlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d4ffwc2:

• d4ffwc2 first appeared in SCOPe 2.03
  
• d4ffwc2 appears in SCOPe 2.05
  
• d4ffwc2 appears in SCOPe 2.07
  
• d4ffwc2 appears in the current release, SCOPe 2.08