Lineage for d4ffwc2 (4ffw C:107-210)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753030Domain d4ffwc2: 4ffw C:107-210 [221195]
    Other proteins in same PDB: d4ffwa1, d4ffwa2, d4ffwb1, d4ffwb2, d4ffwc1, d4ffwd_, d4ffwh_, d4ffwl1
    automated match to d1z3gl2
    complexed with 715

Details for d4ffwc2

PDB Entry: 4ffw (more details), 2.9 Å

PDB Description: crystal structure of dipeptidyl peptidase iv (dpp4, dpp-iv, cd26) in complex with fab + sitagliptin
PDB Compounds: (C:) Fab light chain

SCOPe Domain Sequences for d4ffwc2:

Sequence, based on SEQRES records: (download)

>d4ffwc2 b.1.1.2 (C:107-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Sequence, based on observed residues (ATOM records): (download)

>d4ffwc2 b.1.1.2 (C:107-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgservlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d4ffwc2:

Click to download the PDB-style file with coordinates for d4ffwc2.
(The format of our PDB-style files is described here.)

Timeline for d4ffwc2: