![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
![]() | Protein automated matches [190543] (131 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [188292] (9 PDB entries) |
![]() | Domain d4ffwb2: 4ffw B:510-767 [221193] Other proteins in same PDB: d4ffwa1, d4ffwb1, d4ffwc1, d4ffwc2, d4ffwd_, d4ffwh_, d4ffwl1, d4ffwl2 automated match to d1orva2 complexed with 715 |
PDB Entry: 4ffw (more details), 2.9 Å
SCOPe Domain Sequences for d4ffwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ffwb2 c.69.1.0 (B:510-767) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} mpskkldfivlnetrfwyqmilpphfdkskkypllidvyagpcsqkadaafrlnwatyla steniivasfdgrgsgyqgdkimhainkrlgtlevedqieaarqflkmgfvdskrvaiwg wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv msraenfkqveyllihgtaddnvhfqqsaqiskalvdagvdfqamwytdedhgiasstah qhiyshmshflqqcfslr
Timeline for d4ffwb2: