Lineage for d4ffwb1 (4ffw B:39-509)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076457Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2076570Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 2076571Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
    Pfam PF00930
  6. 2076840Protein automated matches [226889] (3 species)
    not a true protein
  7. 2076848Species Norway rat (Rattus norvegicus) [TaxId:10116] [225089] (7 PDB entries)
  8. 2076862Domain d4ffwb1: 4ffw B:39-509 [221192]
    Other proteins in same PDB: d4ffwa2, d4ffwb2, d4ffwc1, d4ffwc2, d4ffwl1, d4ffwl2
    automated match to d1orva1
    complexed with 715

Details for d4ffwb1

PDB Entry: 4ffw (more details), 2.9 Å

PDB Description: crystal structure of dipeptidyl peptidase iv (dpp4, dpp-iv, cd26) in complex with fab + sitagliptin
PDB Compounds: (B:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d4ffwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ffwb1 b.70.3.1 (B:39-509) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtytladylkntfrvksyslrwvsdseylykqennillfnaehgnssiflenstfeifgd
sisdysvspdrlfvlleynyvkqwrhsytasysiydlnkrqliteekipnntqwitwsqe
ghklayvwkndiyvkiephlpshritstgkenvifngindwvyeeeifgaysalwwspng
tflayaqfndtgvplieysfysdeslqypktvwipypkagavnptvkffivntdslsstt
ttipmqitapasvttgdhylcdvawvsedrislqwlrriqnysvmaicdydkttlvwncp
ttqehietsatgwcgrfrpaephftsdgssfykivsdkdgykhicqfqkdrkpeqvctfi
tkgawevisiealtsdylyyisneykempggrnlykiqltdhtnkkclscdlnpercqyy
svslskeakyyqlgcrgpglplytlhrstdqkelrvlednsaldkmlqdvq

SCOPe Domain Coordinates for d4ffwb1:

Click to download the PDB-style file with coordinates for d4ffwb1.
(The format of our PDB-style files is described here.)

Timeline for d4ffwb1: