Lineage for d4ffwa2 (4ffw A:510-765)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1382311Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1382312Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1384148Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1384149Protein automated matches [190543] (40 species)
    not a true protein
  7. 1384296Species Norway rat (Rattus norvegicus) [TaxId:10116] [188292] (5 PDB entries)
  8. 1384307Domain d4ffwa2: 4ffw A:510-765 [221191]
    Other proteins in same PDB: d4ffwa1, d4ffwb1, d4ffwc1, d4ffwc2, d4ffwl1, d4ffwl2
    automated match to d1orva2
    complexed with 715

Details for d4ffwa2

PDB Entry: 4ffw (more details), 2.9 Å

PDB Description: crystal structure of dipeptidyl peptidase iv (dpp4, dpp-iv, cd26) in complex with fab + sitagliptin
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d4ffwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ffwa2 c.69.1.0 (A:510-765) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpskkldfivlnetrfwyqmilpphfdkskkypllidvyagpcsqkadaafrlnwatyla
steniivasfdgrgsgyqgdkimhainkrlgtlevedqieaarqflkmgfvdskrvaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdagvdfqamwytdedhgiasstah
qhiyshmshflqqcfs

SCOPe Domain Coordinates for d4ffwa2:

Click to download the PDB-style file with coordinates for d4ffwa2.
(The format of our PDB-style files is described here.)

Timeline for d4ffwa2: