| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
| Protein automated matches [190543] (131 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [188292] (9 PDB entries) |
| Domain d4ffwa2: 4ffw A:510-765 [221191] Other proteins in same PDB: d4ffwa1, d4ffwb1, d4ffwc1, d4ffwc2, d4ffwd_, d4ffwh_, d4ffwl1, d4ffwl2 automated match to d1orva2 complexed with 715 |
PDB Entry: 4ffw (more details), 2.9 Å
SCOPe Domain Sequences for d4ffwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ffwa2 c.69.1.0 (A:510-765) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpskkldfivlnetrfwyqmilpphfdkskkypllidvyagpcsqkadaafrlnwatyla
steniivasfdgrgsgyqgdkimhainkrlgtlevedqieaarqflkmgfvdskrvaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdagvdfqamwytdedhgiasstah
qhiyshmshflqqcfs
Timeline for d4ffwa2: