Lineage for d4ffvl2 (4ffv L:107-210)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2030580Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)
  8. 2031024Domain d4ffvl2: 4ffv L:107-210 [221189]
    Other proteins in same PDB: d4ffva1, d4ffva2, d4ffvb1, d4ffvb2, d4ffvc1, d4ffvl1
    automated match to d1z3gl2

Details for d4ffvl2

PDB Entry: 4ffv (more details), 2.4 Å

PDB Description: crystal structure of dipeptidyl peptidase iv (dpp4, dpp-iv, cd26) in complex with 11a19 fab
PDB Compounds: (L:) 11A19 Fab light chain

SCOPe Domain Sequences for d4ffvl2:

Sequence, based on SEQRES records: (download)

>d4ffvl2 b.1.1.2 (L:107-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Sequence, based on observed residues (ATOM records): (download)

>d4ffvl2 b.1.1.2 (L:107-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgsegvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d4ffvl2:

Click to download the PDB-style file with coordinates for d4ffvl2.
(The format of our PDB-style files is described here.)

Timeline for d4ffvl2: