SCOPe 2.03: Domain d4ffvc1: 4ffv C:1-106

Lineage for d4ffvc1 (4ffv C:1-106)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)

8. Domain d4ffvc1: 4ffv C:1-106 [221186]
   Other proteins in same PDB: d4ffva1, d4ffva2, d4ffvb1, d4ffvb2, d4ffvc2, d4ffvl2
   automated match to d1sy6l1

Details for d4ffvc1

PDB Entry: 4ffv, 2.4 Å

PDB Description: crystal structure of dipeptidyl peptidase iv (dpp4, dpp-iv, cd26) in complex with 11a19 fab

PDB Compounds: (C:) 11A19 Fab light chain

SCOPe Domain Sequences for d4ffvc1:

Sequence; same for both SEQRES and ATOM records:

>d4ffvc1 b.1.1.0 (C:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qivlsqspailsaspgekvtmtcrasssvnnmhwyqqkpgsspkpwlhgtsnlasgvpvr
fsgsgsgtsfsltisrveaedaatyfcqqwsnhpptfgggtkleid

Timeline for d4ffvc1:

• d4ffvc1 is new in SCOPe 2.03-stable
  
• d4ffvc1 appears in SCOPe 2.04
  
• d4ffvc1 appears in the current release, SCOPe 2.08